LL-37

For Research Use Only | Not for Human or Veterinary Use

---

Description: LL-37 is a naturally occurring 37-amino acid antimicrobial peptide derived from the C-terminal region of human cathelicidin antimicrobial protein (hCAP18). As a component of the innate immune system, LL-37 is extensively investigated in laboratory research for its antimicrobial activity, immunomodulatory signaling, and involvement in cellular processes associated with inflammation and tissue repair. In preclinical research models, LL-37 is studied for its interactions with microbial membranes as well as its influence on immune-cell signaling, cytokine activity, cellular migration, and angiogenic pathways. Its combination of antimicrobial and immunomodulatory properties makes LL-37 a valuable research tool for investigating host-defense mechanisms, innate immunity, inflammatory responses, and regenerative biological processes.

---

Scientific Specifications:

• Peptide Name: LL-37 (Human Cathelicidin Antimicrobial Peptide)
• Type: Antimicrobial and Immunomodulatory Peptide
• Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
• Sequence (One-Letter Code): [LL-37, 37 aa]
• Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃
• Molecular Weight: ~4493.3 g/mol
• CAS Number: 154947-66-7
• PubChem CID: 16129608
• Form: Lyophilized powder
• Storage: Store dry in a cool, dark environment at 2°C to 8°C

---

Research Context: LL-37 is commonly investigated in laboratory research involving:

• Antimicrobial activity and interactions with microbial membrane structures
• Innate immune signaling and host-defense mechanisms
• Cytokine and chemokine signaling within inflammatory research models
• Immune-cell recruitment, migration, and cellular response pathways
• Angiogenic signaling and processes associated with vascular development
• Cellular migration, tissue remodeling, and experimental wound-repair mechanisms

---

Intended Use: This product is intended strictly for laboratory research applications only by qualified scientific personnel. It is not approved for human or animal consumption and may not be used in foods, drugs, supplements, cosmetics, or diagnostics.

---

Legal Disclaimer: The information provided is intended solely for laboratory research and informational purposes. No claims are made regarding the diagnosis, treatment, cure, or prevention of any disease. This product is not intended for human or veterinary use and should only be handled by qualified research personnel in appropriate laboratory environments.

---

Terms of Sale: By purchasing this product, the buyer affirms they are a qualified researcher or institutional purchaser and accepts full responsibility for proper handling, storage, and legal compliance.